# /usr/local/bin/fasta34_t -T 8 -b50 -d10 -E0.01 -H -O./tmp/as00097.fasta.nr -Q ../query/FLJ00097.ptfa /cdna2/lib/nr/nr 2
FASTA searches a protein or DNA sequence data bank version 34.26.5 April 26, 2007
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

 FLJ00097, 85 aa
 vs /cdna2/lib/nr/nr library

2693465022 residues in 7827732 sequences
 statistics sampled from 60000 to 7827110 sequences
  Expectation_n fit: rho(ln(x))= 4.9885+/-0.000186; mu= 4.9379+/- 0.010
 mean_var=64.4251+/-12.689, 0's: 47 Z-trim: 48  B-trim: 1460 in 2/66
 Lambda= 0.159789

FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2
 join: 36, opt: 24, open/ext: -10/-2, width:  16
The best scores are:                                      opt bits E(7827732)
gi|18676432|dbj|BAB84868.1| FLJ00097 protein [Homo (  85)  584 142.0 9.9e-33


>>gi|18676432|dbj|BAB84868.1| FLJ00097 protein [Homo sap  (85 aa)
 initn: 584 init1: 584 opt: 584  Z-score: 743.8  bits: 142.0 E(): 9.9e-33
Smith-Waterman score: 584;  100.000% identity (100.000% similar) in 85 aa overlap (1-85:1-85)

               10        20        30        40        50        60
FLJ000 ALDRKSLDCPEEVVSRNMDVKGAPAEVLGGNEGHDIGREDGGGDCSDASTDLGDQDAAAI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
gi|186 ALDRKSLDCPEEVVSRNMDVKGAPAEVLGGNEGHDIGREDGGGDCSDASTDLGDQDAAAI
               10        20        30        40        50        60

               70        80     
FLJ000 TAGGKGEDRGPLRASRRSQACRPLG
       :::::::::::::::::::::::::
gi|186 TAGGKGEDRGPLRASRRSQACRPLG
               70        80     




85 residues in 1 query   sequences
2693465022 residues in 7827732 library sequences
 Tcomplib [34.26] (2 proc)
 start: Fri Feb 27 22:11:14 2009 done: Fri Feb 27 22:14:47 2009
 Total Scan time: 479.950 Total Display time:  0.000

Function used was FASTA [version 34.26.5 April 26, 2007]