# /usr/local/bin/fasta34_t -T 8 -b50 -d10 -E0.01 -H -O./tmp/sh04774.fasta.nr -Q ../query/FLJ00363.ptfa /cdna2/lib/nr/nr 2 FASTA searches a protein or DNA sequence data bank version 34.26.5 April 26, 2007 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 FLJ00363, 151 aa vs /cdna2/lib/nr/nr library 2693465022 residues in 7827732 sequences statistics sampled from 60000 to 7827236 sequences Expectation_n fit: rho(ln(x))= 4.6615+/-0.000184; mu= 9.3966+/- 0.010 mean_var=64.6248+/-12.793, 0's: 40 Z-trim: 42 B-trim: 1561 in 1/64 Lambda= 0.159542 FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 The best scores are: opt bits E(7827732) gi|21748572|dbj|BAC03423.1| FLJ00363 protein [Homo ( 151) 1093 259.3 1.5e-67 >>gi|21748572|dbj|BAC03423.1| FLJ00363 protein [Homo sap (151 aa) initn: 1093 init1: 1093 opt: 1093 Z-score: 1368.8 bits: 259.3 E(): 1.5e-67 Smith-Waterman score: 1093; 100.000% identity (100.000% similar) in 151 aa overlap (1-151:1-151) 10 20 30 40 50 60 FLJ003 KGESELKMQKRRGRFWSRWRGAFQQPQQTAQWFAVGDGVDQKHRPVDTLGSDGGPCLSAS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 KGESELKMQKRRGRFWSRWRGAFQQPQQTAQWFAVGDGVDQKHRPVDTLGSDGGPCLSAS 10 20 30 40 50 60 70 80 90 100 110 120 FLJ003 SLFPPPRNVQFHPTCQPLFMHPCMYTFFFVLRMPYLAKIPSLQNAPQRSLLLVCSASLLH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 SLFPPPRNVQFHPTCQPLFMHPCMYTFFFVLRMPYLAKIPSLQNAPQRSLLLVCSASLLH 70 80 90 100 110 120 130 140 150 FLJ003 LLYHDDIFPVCLTCLHSLGKLVCLRNRQRSF ::::::::::::::::::::::::::::::: gi|217 LLYHDDIFPVCLTCLHSLGKLVCLRNRQRSF 130 140 150 151 residues in 1 query sequences 2693465022 residues in 7827732 library sequences Tcomplib [34.26] (2 proc) start: Fri Feb 27 21:33:19 2009 done: Fri Feb 27 21:37:24 2009 Total Scan time: 586.790 Total Display time: 0.000 Function used was FASTA [version 34.26.5 April 26, 2007]