# /usr/local/bin/fasta34_t -T 8 -b50 -d10 -E0.01 -H -O./tmp/sj01834.fasta.nr -Q ../query/FLJ00326.ptfa /cdna2/lib/nr/nr 2 FASTA searches a protein or DNA sequence data bank version 34.26.5 April 26, 2007 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 FLJ00326, 122 aa vs /cdna2/lib/nr/nr library 2693465022 residues in 7827732 sequences statistics sampled from 60000 to 7827389 sequences Expectation_n fit: rho(ln(x))= 4.7934+/-0.000181; mu= 7.5984+/- 0.010 mean_var=60.7156+/-11.863, 0's: 38 Z-trim: 41 B-trim: 0 in 0/67 Lambda= 0.164598 FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 The best scores are: opt bits E(7827732) gi|21748524|dbj|BAC03399.1| FLJ00326 protein [Homo ( 122) 859 211.4 2.7e-53 >>gi|21748524|dbj|BAC03399.1| FLJ00326 protein [Homo sap (122 aa) initn: 859 init1: 859 opt: 859 Z-score: 1113.1 bits: 211.4 E(): 2.7e-53 Smith-Waterman score: 859; 100.000% identity (100.000% similar) in 122 aa overlap (1-122:1-122) 10 20 30 40 50 60 FLJ003 ELRPISLQRSFPGPETERHTVCRCRDTMSLGGSTPRVVKTPPTAHLGLSSFSPLSLFKGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 ELRPISLQRSFPGPETERHTVCRCRDTMSLGGSTPRVVKTPPTAHLGLSSFSPLSLFKGP 10 20 30 40 50 60 70 80 90 100 110 120 FLJ003 GLASTRGFHGFRFSFPSFFPKVAGTRAAFQHFMGHLVLLAVWPKAPQFLHLSCGWKGSDV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 GLASTRGFHGFRFSFPSFFPKVAGTRAAFQHFMGHLVLLAVWPKAPQFLHLSCGWKGSDV 70 80 90 100 110 120 FLJ003 SE :: gi|217 SE 122 residues in 1 query sequences 2693465022 residues in 7827732 library sequences Tcomplib [34.26] (2 proc) start: Fri Feb 27 15:34:45 2009 done: Fri Feb 27 15:38:34 2009 Total Scan time: 541.660 Total Display time: 0.000 Function used was FASTA [version 34.26.5 April 26, 2007]