# /usr/local/bin/fasta34_t -T 8 -b50 -d10 -E0.01 -H -O./tmp/sj07511.fasta.nr -Q ../query/FLJ00402.ptfa /cdna2/lib/nr/nr 2 FASTA searches a protein or DNA sequence data bank version 34.26.5 April 26, 2007 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 FLJ00402, 137 aa vs /cdna2/lib/nr/nr library 2693465022 residues in 7827732 sequences statistics sampled from 60000 to 7823498 sequences Expectation_n fit: rho(ln(x))= 5.5183+/-0.000193; mu= 5.7214+/- 0.011 mean_var=96.7457+/-18.447, 0's: 39 Z-trim: 42 B-trim: 69 in 1/65 Lambda= 0.130394 FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 The best scores are: opt bits E(7827732) gi|21748648|dbj|BAC03461.1| FLJ00402 protein [Homo ( 137) 1014 199.6 1.2e-49 >>gi|21748648|dbj|BAC03461.1| FLJ00402 protein [Homo sap (137 aa) initn: 1014 init1: 1014 opt: 1014 Z-score: 1047.5 bits: 199.6 E(): 1.2e-49 Smith-Waterman score: 1014; 100.000% identity (100.000% similar) in 137 aa overlap (1-137:1-137) 10 20 30 40 50 60 FLJ004 QVSLVRTMPSRCHCHSPILPNPPSLPPSLPTLIPPPFLLWGKFSHSHSQTPAPRIWAQGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 QVSLVRTMPSRCHCHSPILPNPPSLPPSLPTLIPPPFLLWGKFSHSHSQTPAPRIWAQGP 10 20 30 40 50 60 70 80 90 100 110 120 FLJ004 RSRDAGRGPAPKGRGGRGSACCLPWGRSEVPGTPVRVPAAAAREWAKREHACISKKPARS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: gi|217 RSRDAGRGPAPKGRGGRGSACCLPWGRSEVPGTPVRVPAAAAREWAKREHACISKKPARS 70 80 90 100 110 120 130 FLJ004 LDFPVFALHPRSPSTHT ::::::::::::::::: gi|217 LDFPVFALHPRSPSTHT 130 137 residues in 1 query sequences 2693465022 residues in 7827732 library sequences Tcomplib [34.26] (2 proc) start: Sat Feb 28 01:46:46 2009 done: Sat Feb 28 01:50:41 2009 Total Scan time: 569.270 Total Display time: 0.010 Function used was FASTA [version 34.26.5 April 26, 2007]