hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15565426/chunk_1/iprscan-20080501-15565426.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0049 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00564.15.fs PB1 domain 71.6 1.1e-19 1 PF00564.15.ls PB1 domain 73.5 6.2e-19 1 PF00627.21.fs UBA/TS-N domain 21.8 1.8e-05 1 PF00627.21.ls UBA/TS-N domain 23.8 0.00056 1 PF00569.8.ls Zinc finger, ZZ type 16.1 0.002 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00564.15.fs 1/1 7 88 .. 1 89 [] 71.6 1.1e-19 PF00564.15.ls 1/1 7 88 .. 1 89 [] 73.5 6.2e-19 PF00569.8.ls 1/1 214 257 .. 1 46 [] 16.1 0.002 PF00627.21.fs 1/1 919 959 .. 1 41 [] 21.8 1.8e-05 PF00627.21.ls 1/1 919 959 .. 1 41 [] 23.8 0.00056 Alignments of top-scoring domains: PF00564.15.fs: domain 1 of 1, from 7 to 88: score 71.6, E = 1.1e-19 *->tvriKlrygggirrfilsvsrgisfeeLrskvaqrfgldvtfklkYp +v++ ++++++i f +s ++++++ + ++v+ f l +t+++kY+ KIAA0049 7 QVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDL-NTIQIKYL 52 DeDgDdlVsitsDeDLeeaieearsllsesksktlrlhvfpa<-* De++ ++Vsi+s+ ++eea+++a + ++++l+++v+++ KIAA0049 53 DEEN-EEVSINSQGEYEEALKMAVK-----QGNQLQMQVHEG 88 PF00564.15.ls: domain 1 of 1, from 7 to 88: score 73.5, E = 6.2e-19 *->tvriKlrygggirrfilsvsrgisfeeLrskvaqrfgldvtfklkYp +v++ ++++++i f +s ++++++ + ++v+ f l +t+++kY+ KIAA0049 7 QVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDL-NTIQIKYL 52 DeDgDdlVsitsDeDLeeaieearsllsesksktlrlhvfpa<-* De++ ++Vsi+s+ ++eea+++a + ++++l+++v+++ KIAA0049 53 DEEN-EEVSINSQGEYEEALKMAVK-----QGNQLQMQVHEG 88 PF00569.8.ls: domain 1 of 1, from 214 to 257: score 16.1, E = 0.002 *->ihkvytCdgCkeapiigvRYhClrCsdYDLCqsCfstGhkagkHkm< + C+ C i+gvRY C C+ Y++C C+ ++++ KIAA0049 214 FSWHIACNNCQR-RIVGVRYQCSLCPSYNICEDCEAG-PYGHDTNH 257 -* KIAA0049 - - PF00627.21.fs: domain 1 of 1, from 919 to 959: score 21.8, E = 1.8e-05 *->ideeavkqLreMTGf.dreeakkALeatngnverAvewLleh<-* +++++ + L eM Gf dr+ + + L+++n+n+ + v Ll+ KIAA0049 919 QTAALMAHLFEM-GFcDRQLNLRLLKKHNYNILQVVTELLQL 959 PF00627.21.ls: domain 1 of 1, from 919 to 959: score 23.8, E = 0.00056 *->ideeavkqLreMTGf.dreeakkALeatngnverAvewLleh<-* +++++ + L eM Gf dr+ + + L+++n+n+ + v Ll+ KIAA0049 919 QTAALMAHLFEM-GFcDRQLNLRLLKKHNYNILQVVTELLQL 959 //