hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16460002/chunk_1/iprscan-20080501-16460002.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0078 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04825.4.ls N terminus of Rad21 / Rec8 like protein 238.8 1.1e-68 1 PF04825.4.fs N terminus of Rad21 / Rec8 like protein 237.0 3.9e-68 1 PF04824.7.fs Conserved region of Rad21 / Rec8 like pr 102.7 2.1e-28 1 PF04824.7.ls Conserved region of Rad21 / Rec8 like pr 104.7 2.6e-28 1 PF02616.5.fs ScpA/B protein 16.4 0.00013 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04825.4.fs 1/1 5 115 .. 1 136 [] 237.0 3.9e-68 PF04825.4.ls 1/1 5 115 .. 1 136 [] 238.8 1.1e-68 PF04824.7.fs 1/1 578 632 .. 1 55 [] 102.7 2.1e-28 PF04824.7.ls 1/1 578 632 .. 1 55 [] 104.7 2.6e-28 PF02616.5.fs 1/1 583 629 .. 227 283 .] 16.4 0.00013 Alignments of top-scoring domains: PF04825.4.fs: domain 1 of 1, from 5 to 115: score 237.0, E = 3.9e-68 *->MFYshavLskeKGPLakIWLAAiLGtghwekKLkKkqiletdIpesc MFY+h+vLsk +GPLakIWLAA hw+kKL+K++++e+++++s+ KIAA0078 5 MFYAHFVLSK-RGPLAKIWLAA-----HWDKKLTKAHVFECNLESSV 45 eeIlnpvlvRvvPerergsevdplALRlsghLLlGVVRiYskKvkYLldD e+I+ p +v ++ALR+sghLLlGVVRiY +K+kYLl+D KIAA0078 46 ESIISP-------------KV-KMALRTSGHLLLGVVRIYHRKAKYLLAD 81 cneallkvkkaFrsgqldfevdlPeenrearvnsnltlp<-* cnea++k+k+aFr+g vdlPeenrea +n+ +tlp KIAA0078 82 CNEAFIKIKMAFRPGV----VDLPEENREAAYNA-ITLP 115 PF04825.4.ls: domain 1 of 1, from 5 to 115: score 238.8, E = 1.1e-68 *->MFYshavLskeKGPLakIWLAAiLGtghwekKLkKkqiletdIpesc MFY+h+vLsk +GPLakIWLAA hw+kKL+K++++e+++++s+ KIAA0078 5 MFYAHFVLSK-RGPLAKIWLAA-----HWDKKLTKAHVFECNLESSV 45 eeIlnpvlvRvvPerergsevdplALRlsghLLlGVVRiYskKvkYLldD e+I+ p +v ++ALR+sghLLlGVVRiY +K+kYLl+D KIAA0078 46 ESIISP-------------KV-KMALRTSGHLLLGVVRIYHRKAKYLLAD 81 cneallkvkkaFrsgqldfevdlPeenrearvnsnltlp<-* cnea++k+k+aFr+g vdlPeenrea +n+ +tlp KIAA0078 82 CNEAFIKIKMAFRPGV----VDLPEENREAAYNA-ITLP 115 PF04824.7.fs: domain 1 of 1, from 578 to 632: score 102.7, E = 2.1e-28 *->tegeklslsqLpagttRkeAArlFYelLVLktegaIdVkQeePYgdI t+ e++sl++L+++t+Rk+AA++FY++LVLk+++aI+++QeePY+dI KIAA0078 578 TGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDI 624 likagPkl<-* + ++gP++ KIAA0078 625 IATPGPRF 632 PF04824.7.ls: domain 1 of 1, from 578 to 632: score 104.7, E = 2.6e-28 *->tegeklslsqLpagttRkeAArlFYelLVLktegaIdVkQeePYgdI t+ e++sl++L+++t+Rk+AA++FY++LVLk+++aI+++QeePY+dI KIAA0078 578 TGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDI 624 likagPkl<-* + ++gP++ KIAA0078 625 IATPGPRF 632 PF02616.5.fs: domain 1 of 1, from 583 to 629: score 16.4, E = 0.00013 *->isFfeLvkdcHHHLDPnhliskkdlVgaFlALLeLannqkVeleQee is+ eL + +k + F + L+L ++q++el Qee KIAA0078 583 ISLLELCRN----------TNRKQAAAKFYSFLVLKKQQAIELTQEE 619 ffgdlyiqll<-* +++d++ ++ KIAA0078 620 PYSDIIATPG 629 //