hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-19574248/chunk_1/iprscan-20080501-19574248.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0194 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00505.9.fs HMG (high mobility group) box 42.4 2.9e-11 1 PF00505.9.ls HMG (high mobility group) box 34.3 3.8e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00505.9.fs 1/1 185 243 .. 1 59 [. 42.4 2.9e-11 PF00505.9.ls 1/1 185 253 .. 1 69 [] 34.3 3.8e-07 Alignments of top-scoring domains: PF00505.9.fs: domain 1 of 1, from 185 to 243: score 42.4, E = 2.9e-11 *->PKRPlsAFflfrqeqRakikaenPglsnaeIskklGekWkaLseeeK +K+P+sA++l++ + + k+ +e P+l +eI kk++e W+ Ls +e+ KIAA0194 185 TKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAER 231 apYeakAekeKa<-* Y +kA+ eK+ KIAA0194 232 SYYLEKAKLEKE 243 PF00505.9.ls: domain 1 of 1, from 185 to 253: score 34.3, E = 3.8e-07 *->PKRPlsAFflfrqeqRakikaenPglsnaeIskklGekWkaLseeeK +K+P+sA++l++ + + k+ +e P+l +eI kk++e W+ Ls +e+ KIAA0194 185 TKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAER 231 apYeakAekeKarYekempeYk<-* Y +kA+ eK+ + + KIAA0194 232 SYYLEKAKLEKEGLDPNSKLSA 253 //