hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-20354192/chunk_1/iprscan-20080501-20354192.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0217 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00715 136.4 3e-36 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00715 1/1 167 245 .. 1 92 [] 136.4 3e-36 Alignments of top-scoring domains: SM00715: domain 1 of 1, from 167 to 245: score 136.4, E = 3e-36 *->eelkqkikkQvEYYFSdeNLprDkFLrkkmdknkdGyVPistiasFk e+ ++ +kk +E++ S+eNL++D++L+++md+ d+yVPi+t+a+ KIAA0217 167 EDPREVLKKTLEFCLSRENLASDMYLISQMDS--DQYVPITTVANLD 211 RvksLttDGdDIpyevnlIveALreSyeaellevsedmglkvRRt<-* ++k+L+tD v+lIve+Lr+ +l++v+e+ g+kvR++ KIAA0217 212 HIKKLSTD-------VDLIVEVLRSL---PLVQVDEK-GEKVRPN 245 //