hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23112339/chunk_1/iprscan-20080501-23112339.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0306 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00398 74.4 1.4e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00398 1/1 42 112 .. 1 71 [] 74.4 1.4e-17 Alignments of top-scoring domains: SM00398: domain 1 of 1, from 42 to 112: score 74.4, E = 1.4e-17 *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee +++rPm+afm+Fs+ +Ra + + +P+ n+ +sK+lge+W +L ++e KIAA0306 42 HIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKE 88 KapYeekAekdkeryekempeykk<-* K++Y+++A + ke + k++p++k KIAA0306 89 KQKYHDLAFQVKEAHFKAHPDWKW 112 //