hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23572702/chunk_1/iprscan-20080501-23572702.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0330 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF09047.1.fs MEF2 binding 78.9 2.9e-22 1 PF09047.1.ls MEF2 binding 80.8 3.8e-21 1 PF07719.7.fs Tetratricopeptide repeat 65.3 2.8e-17 7 PF07719.7.ls Tetratricopeptide repeat 65.0 2.3e-16 5 PF00515.18.fs Tetratricopeptide repeat 53.1 4.3e-14 6 PF00515.18.ls Tetratricopeptide repeat 48.6 2e-11 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00515.18.fs 2/6 94 127 .. 1 34 [] 20.0 0.00011 PF00515.18.ls 1/4 94 127 .. 1 34 [] 22.0 0.0019 PF00515.18.ls 2/4 128 161 .. 1 34 [] 15.9 0.064 PF00515.18.fs 3/6 128 161 .. 1 34 [] 13.9 0.0062 PF00515.18.fs 6/6 1130 1143 .. 21 34 .] 8.0 0.28 PF09047.1.ls 1/1 2160 2194 .. 1 35 [] 80.8 3.8e-21 PF09047.1.fs 1/1 2160 2194 .. 1 35 [] 78.9 2.9e-22 Alignments of top-scoring domains: PF00515.18.fs: domain 2 of 6, from 94 to 127: score 20.0, E = 0.00011 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* + +y+nl+++ ++++++ A e+y +A+ ld ++ KIAA0330 94 YSTYKNLAQLAAQREDLETAMEFYLEAVMLDSTD 127 PF00515.18.ls: domain 1 of 4, from 94 to 127: score 22.0, E = 0.0019 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* + +y+nl+++ ++++++ A e+y +A+ ld ++ KIAA0330 94 YSTYKNLAQLAAQREDLETAMEFYLEAVMLDSTD 127 PF00515.18.ls: domain 2 of 4, from 128 to 161: score 15.9, E = 0.064 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* ++ +y +G++ l+l + A a+e+ L+ +P++ KIAA0330 128 VNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDH 161 PF00515.18.fs: domain 3 of 6, from 128 to 161: score 13.9, E = 0.0062 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* ++ +y +G++ l+l + A a+e+ L+ +P++ KIAA0330 128 VNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDH 161 PF00515.18.fs: domain 6 of 6, from 1130 to 1143: score 8.0, E = 0.28 *->ieayekALeldPnn<-* + ++++ALe+d +n KIAA0330 1130 LNCFRRALEIDSSN 1143 PF09047.1.ls: domain 1 of 1, from 2160 to 2194: score 80.8, E = 3.8e-21 *->tLLsPKGsisEEtKqKLKsviLsaqsAAtvkKesL<-* tLLsPKGsisEEtKqKLKs+iLsaqsAA+v+KesL KIAA0330 2160 TLLSPKGSISEETKQKLKSAILSAQSAANVRKESL 2194 PF09047.1.fs: domain 1 of 1, from 2160 to 2194: score 78.9, E = 2.9e-22 *->tLLsPKGsisEEtKqKLKsviLsaqsAAtvkKesL<-* tLLsPKGsisEEtKqKLKs+iLsaqsAA+v+KesL KIAA0330 2160 TLLSPKGSISEETKQKLKSAILSAQSAANVRKESL 2194 //