hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-00042498/chunk_1/iprscan-20080502-00042498.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0334 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00091 66.4 3.6e-15 2 SM00353 54.4 1.4e-11 1 SM00086 38.3 1.1e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00353 1/1 42 92 .. 1 61 [] 54.4 1.4e-11 SM00091 1/2 111 177 .. 1 68 [] 37.0 2.6e-06 SM00091 2/2 266 332 .. 1 68 [] 29.4 0.00048 SM00086 1/1 338 381 .. 1 43 [] 38.3 1.1e-06 Alignments of top-scoring domains: SM00353: domain 1 of 1, from 42 to 92: score 54.4, E = 1.4e-11 *->narERrlrRRekiNeqafdeLrslvPtlpkgggnskKlsKasiLrlA n +E+ +RR++ N ++eL s++P gn +K++K ++L++ KIAA0334 42 NKSEK--KRRDQFNV-LIKELGSMLP------GNARKMDKSTVLQKS 79 ieYIrksLqeqlqe<-* i+++ ++ +e ++ KIAA0334 80 IDFL-RKHKEITAQ 92 SM00091: domain 1 of 2, from 111 to 177: score 37.0, E = 2.6e-06 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll e+ + +le+l+ +++++ dG i+y++++++ ll p +l+++s++ KIAA0334 111 EFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIF 157 elihpedrlleevqe.lqrlla<-* ++i+++++ ev l ++l KIAA0334 158 NFIPEGEH--SEVYKiLSTHLL 177 SM00091: domain 2 of 2, from 266 to 332: score 29.4, E = 0.00048 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll ++ ++ e ++ +++l++++l+ +++a + Gy p e++G+s + KIAA0334 266 KEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGY 312 elihpedrlleevqe.lqrlla<-* +++h +d+ e + +++l++ KIAA0334 313 DYYHVDDL--ENLAKcHEHLMQ 332 SM00086: domain 1 of 1, from 338 to 381: score 38.3, E = 1.1e-06 *->tveyrlrrkdGsliwvlvsaspird.edgevegilgvvrDITer<-* ++ yr+++k++++iw++++ ++ +++++ ++e+i++++++++ + KIAA0334 338 SCYYRFLTKGQQWIWLQTHYYITYHqWNSRPEFIVCTHTVVSYA 381 //