hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-00564456/chunk_1/iprscan-20080502-00564456.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0365 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01805.10.ls Surp module 117.2 4.4e-32 2 PF01805.10.fs Surp module 113.3 5.3e-32 2 PF01585.13.fs G-patch domain 59.7 1.7e-16 1 PF01585.13.ls G-patch domain 61.6 2.3e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01805.10.ls 1/2 689 732 .. 1 47 [] 58.4 2.2e-14 PF01805.10.fs 1/2 689 732 .. 1 47 [] 56.5 1.6e-15 PF01805.10.fs 2/2 887 932 .. 1 47 [] 56.8 1.3e-15 PF01805.10.ls 2/2 887 932 .. 1 47 [] 58.8 1.7e-14 PF01585.13.fs 1/1 1110 1154 .. 1 45 [] 59.7 1.7e-16 PF01585.13.ls 1/1 1110 1154 .. 1 45 [] 61.6 2.3e-15 Alignments of top-scoring domains: PF01805.10.ls: domain 1 of 2, from 689 to 732: score 58.4, E = 2.2e-14 *->IkktArfVaknGleFeamlleretkndprFnFLkpsndplhkYYkkk I++++++V++++l++++++l +e dp+++FL+++n++++kYYk+k KIAA0365 689 IDQLVKRVIEGSLSPKERTLLKE---DPAYWFLSDENSLEYKYYKLK 732 <-* KIAA0365 - - PF01805.10.fs: domain 1 of 2, from 689 to 732: score 56.5, E = 1.6e-15 *->IkktArfVaknGleFeamlleretkndprFnFLkpsndplhkYYkkk I++++++V++++l++++++l +e dp+++FL+++n++++kYYk+k KIAA0365 689 IDQLVKRVIEGSLSPKERTLLKE---DPAYWFLSDENSLEYKYYKLK 732 <-* KIAA0365 - - PF01805.10.fs: domain 2 of 2, from 887 to 932: score 56.8, E = 1.3e-15 *->IkktArfVaknGleFeamlleretkndprFnFLkpsndplhkYYkkk +k+ArfVa+ G+e e+ +e++t+n p ++FL + n++ +k+Y+kk KIAA0365 887 AEKLARFVAQVGPEIEQFSIENSTDN-PDLWFLHDQNSSAFKFYRKK 932 <-* KIAA0365 - - PF01805.10.ls: domain 2 of 2, from 887 to 932: score 58.8, E = 1.7e-14 *->IkktArfVaknGleFeamlleretkndprFnFLkpsndplhkYYkkk +k+ArfVa+ G+e e+ +e++t+n p ++FL + n++ +k+Y+kk KIAA0365 887 AEKLARFVAQVGPEIEQFSIENSTDN-PDLWFLHDQNSSAFKFYRKK 932 <-* KIAA0365 - - PF01585.13.fs: domain 1 of 1, from 1110 to 1154: score 59.7, E = 1.7e-16 *->tsniGfklLqKMGWkeGqGLGkneqGikePieakikpdrkGLGae<- +n Gf++LqKMGWkeG GLG+ ++Gi+eP+++ ++GLGa+ KIAA0365 1110 DKNLGFQMLQKMGWKEGHGLGSLGKGIREPVSVGTPSEGEGLGAD 1154 * KIAA0365 - - PF01585.13.ls: domain 1 of 1, from 1110 to 1154: score 61.6, E = 2.3e-15 *->tsniGfklLqKMGWkeGqGLGkneqGikePieakikpdrkGLGae<- +n Gf++LqKMGWkeG GLG+ ++Gi+eP+++ ++GLGa+ KIAA0365 1110 DKNLGFQMLQKMGWKEGHGLGSLGKGIREPVSVGTPSEGEGLGAD 1154 * KIAA0365 - - //