hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01131885/chunk_1/iprscan-20080502-01131885.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0375 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00593 83.9 1.9e-20 1 SM00326 54.0 2e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00593 1/1 1129 1197 .. 1 68 [] 83.9 1.9e-20 SM00326 1/1 1474 1529 .. 1 58 [] 54.0 2e-11 Alignments of top-scoring domains: SM00593: domain 1 of 1, from 1129 to 1197: score 83.9, E = 1.9e-20 *->frAwirlaLneklLsswLnlLlsdrkllskyYepwAflrsae.adpe f A+i +Ln +L+ w+n+L++++++++++Y+pw+fl a++++p KIAA0375 1129 FNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFLSAAHtVCPG 1175 egeqlltlLqgLsaldfnlpvd<-* ++e+ll lLq+L +l+f+l+++ KIAA0375 1176 LFEELLLLLQPLALLPFSLDLL 1197 SM00326: domain 1 of 1, from 1474 to 1529: score 54.0, E = 2e-11 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG ++v+Al+ + a++++ LsF+kGDi++vl + +++W+++ ++ G KIAA0375 1474 CEVQALCHHLATGPGQLSFHKGDILRVLGRAGGDWLRCSRG--PDSG 1518 lfPsnYVeeie<-* l+P YV++ + KIAA0375 1519 LVPLAYVTLTP 1529 //