hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03104087/chunk_1/iprscan-20080502-03104087.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0444 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00490 102.6 4.5e-26 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00490 1/1 78 162 .. 1 86 [] 102.6 4.5e-26 Alignments of top-scoring domains: SM00490: domain 1 of 1, from 78 to 162: score 102.6, E = 4.5e-26 *->delaelLkellkdpgikvarlHGglsqeeReeilekFrkgki...kv d l+++L+ + g+k+ r++Gg++ R+e++++F++ ++ ++ KIAA0444 78 DLLEDFLEYE----GYKYERIDGGITGGLRQEAIDRFNAPGAqqfCF 120 LvaTdvaerGlDipgvdlVInydlpwspasyiQRiGRaGRaG<-* L++T+++++G+++ +d+VI+yd +w+p ++iQ+ Ra+R+G KIAA0444 121 LLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIG 162 //