hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-06055003/chunk_1/iprscan-20080502-06055003.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0546 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00386 35.2 9e-06 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00386 1/4 1390 1422 .. 1 34 [] 17.5 1.9 SM00386 2/4 1424 1455 .. 1 34 [] 1.0 9.2e+02 SM00386 3/4 1659 1691 .. 1 34 [] 10.1 53 SM00386 4/4 1768 1803 .. 1 34 [] 6.6 1.6e+02 Alignments of top-scoring domains: SM00386: domain 1 of 4, from 1390 to 1422: score 17.5, E = 1.9 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* + + a +++ rale++ ++++W Y+++ ++ KIAA0546 1390 ESLDSALNVLARALENNK-DNPEIWCHYLRLFSK 1422 SM00386: domain 2 of 4, from 1424 to 1455: score 1.0, E = 9.2e+02 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* g +++ + e a+e p + ++W+ ++ +E+ KIAA0546 1424 GTKDEVQEMCETAVEYAP-DYQSFWT-FLHLEST 1455 SM00386: domain 3 of 4, from 1659 to 1691: score 10.1, E = 53 *->gdieraRkiyeralekfpdksvdlWlkYaefEer<-* + +++aR+++ a ek+p ++ ++++ ++f + KIAA0546 1659 NQHDKARAVWLTAFEKNP-QNAEVFYHMCKFFIL 1691 SM00386: domain 4 of 4, from 1768 to 1803: score 6.6, E = 1.6e+02 *->gdieraRkiyeralekfp..dksvdlWlkYaefEer<-* i + + ye al + + d + ++W++Y+ f + KIAA0546 1768 SSIKETVEAYEAALGVAMrcDIVQKIWMDYLVFANN 1803 //