hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-06431055/chunk_1/iprscan-20080502-06431055.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0568 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00681.10.fs Plectin repeat 25.0 1.5e-06 2 PF04508.3.ls Viral A-type inclusion protein repeat 31.7 2.4e-06 7 PF02370.7.ls M protein repeat 23.4 0.00076 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00681.10.fs 1/2 1330 1362 .. 13 45 .] 24.3 2.4e-06 Alignments of top-scoring domains: PF00681.10.fs: domain 1 of 2, from 1330 to 1362: score 24.3, E = 2.4e-06 *->liDPvtgerLsveeAvrrGLvdpetaqkLleae<-* +i+P tg Ls eeA r GL+d ++ kL+++e KIAA0568 1330 VIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQE 1362 //