hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-09263515/chunk_1/iprscan-20080502-09263515.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0660 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02136.11.ls Nuclear transport factor 2 (NTF2) domain 158.1 2.1e-44 1 PF02136.11.fs Nuclear transport factor 2 (NTF2) domain 156.2 7.9e-44 1 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 55.9 6.6e-15 1 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 55.9 1.3e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02136.11.fs 1/1 19 141 .. 1 128 [] 156.2 7.9e-44 PF02136.11.ls 1/1 19 141 .. 1 128 [] 158.1 2.1e-44 PF00076.12.fs 1/1 341 397 .. 1 59 [. 55.9 6.6e-15 PF00076.12.ls 1/1 341 412 .. 1 74 [] 55.9 1.3e-13 Alignments of top-scoring domains: PF02136.11.fs: domain 1 of 1, from 19 to 141: score 156.2, E = 7.9e-44 *->vakaFvqqYYaaldagdpeglaalYyadaSvltppGq..dgt.mspv v+++Fv+qYY++l++ pe l+++Y + +S + + G + +g++ + v KIAA0660 19 VGREFVRQYYTLLNK-APEYLHRFY-GRNSSYVHGGVdaSGKpQEAV 63 tGleaIneffdsLpfqkiqhlittvDaqptedgaslsdgvlvmVtGeltv +G+ +I+ ++ sL+f+ ++ +i++vDa+ a+lsdgv+v+V+G l + KIAA0660 64 YGQNDIHHKVLSLNFSECHTKIRHVDAH-----ATLSDGVVVQVMGLLSN 108 ddfpprrrFsQtFfLapqrqinggyfVlnDifRl<-* ++p r+F+QtF+Lap+++++++++V+nD+fR+ KIAA0660 109 SGQP-ERKFMQTFVLAPEGSVPNKFYVHNDMFRY 141 PF02136.11.ls: domain 1 of 1, from 19 to 141: score 158.1, E = 2.1e-44 *->vakaFvqqYYaaldagdpeglaalYyadaSvltppGq..dgt.mspv v+++Fv+qYY++l++ pe l+++Y + +S + + G + +g++ + v KIAA0660 19 VGREFVRQYYTLLNK-APEYLHRFY-GRNSSYVHGGVdaSGKpQEAV 63 tGleaIneffdsLpfqkiqhlittvDaqptedgaslsdgvlvmVtGeltv +G+ +I+ ++ sL+f+ ++ +i++vDa+ a+lsdgv+v+V+G l + KIAA0660 64 YGQNDIHHKVLSLNFSECHTKIRHVDAH-----ATLSDGVVVQVMGLLSN 108 ddfpprrrFsQtFfLapqrqinggyfVlnDifRl<-* ++p r+F+QtF+Lap+++++++++V+nD+fR+ KIAA0660 109 SGQP-ERKFMQTFVLAPEGSVPNKFYVHNDMFRY 141 PF00076.12.fs: domain 1 of 1, from 341 to 397: score 55.9, E = 6.6e-15 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lfVgNLp+d++e +Lk++F fG +++ +i ++ g+ +f+FV KIAA0660 341 LFVGNLPHDIDENELKEFFMSFGNVVELRINTK--GVGGKLPNFGFV 385 eFedeedAekAl<-* F+d+e +++ l KIAA0660 386 VFDDSEPVQRIL 397 PF00076.12.ls: domain 1 of 1, from 341 to 412: score 55.9, E = 1.3e-13 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lfVgNLp+d++e +Lk++F fG +++ +i ++ g+ +f+FV KIAA0660 341 LFVGNLPHDIDENELKEFFMSFGNVVELRINTK--GVGGKLPNFGFV 385 eFedeedAekAldalnGkelggrelrv<-* F+d+e +++ l a + + g +l v KIAA0660 386 VFDDSEPVQRILIAKPIMFRGEVRLNV 412 //