hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11305313/chunk_1/iprscan-20080502-11305313.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0733 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02845.6.fs CUE domain 51.2 1.5e-13 1 PF02845.6.ls CUE domain 53.2 7.9e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02845.6.fs 1/1 13 55 .. 1 43 [] 51.2 1.5e-13 PF02845.6.ls 1/1 13 55 .. 1 43 [] 53.2 7.9e-13 Alignments of top-scoring domains: PF02845.6.fs: domain 1 of 1, from 13 to 55: score 51.2, E = 1.5e-13 *->vneealhelkemFPqldksvIravLeantgnveatinnLLegs<-* + ++lh+l++ FP+++++v+++++++n++n++a++++L ++s KIAA0733 13 IDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES 55 PF02845.6.ls: domain 1 of 1, from 13 to 55: score 53.2, E = 7.9e-13 *->vneealhelkemFPqldksvIravLeantgnveatinnLLegs<-* + ++lh+l++ FP+++++v+++++++n++n++a++++L ++s KIAA0733 13 IDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES 55 //