hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11372306/chunk_1/iprscan-20080502-11372306.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0737 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00398 77.8 1.3e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00398 1/1 230 300 .. 1 71 [] 77.8 1.3e-18 Alignments of top-scoring domains: SM00398: domain 1 of 1, from 230 to 300: score 77.8, E = 1.3e-18 *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee p +P sa+ lF + a ik +nP+++++e+sK+++ +W L ee+ KIAA0737 230 EPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ 276 KapYeekAekdkeryekempeykk<-* K+ Y+ k e++k++y k++++yk KIAA0737 277 KQVYKRKTEAAKKEYLKALAAYKD 300 //