hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-16023160/chunk_1/iprscan-20080502-16023160.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0892 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 25.6 0.0069 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/3 115 148 .. 1 34 [] 5.0 1.4e+02 SM00028 2/3 387 420 .. 1 34 [] 7.9 64 SM00028 3/3 467 500 .. 1 34 [] 12.7 18 Alignments of top-scoring domains: SM00028: domain 1 of 3, from 115 to 148: score 5.0, E = 1.4e+02 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* ea + l ++y + + d A ++kA+++ + KIAA0892 115 FEAASLLSELYCQENSVDAAKPLLRKAIQISQQT 148 SM00028: domain 2 of 3, from 387 to 420: score 7.9, E = 64 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a+ + lG+ + + + d A++ ++ AL+l + KIAA0892 387 AQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ 420 SM00028: domain 3 of 3, from 467 to 500: score 12.7, E = 18 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a a+y +G+ + +g+y+eA ++++ L++ KIAA0892 467 AAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAE 500 //