hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-16132961/chunk_1/iprscan-20080502-16132961.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0898 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00502 119.3 4.4e-31 1 SM00061 60.2 2.6e-13 1 SM00336 55.6 6.3e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00336 1/1 105 147 .. 1 51 [] 55.6 6.3e-12 SM00502 1/1 147 269 .. 1 132 [] 119.3 4.4e-31 SM00061 1/1 296 399 .. 1 123 [] 60.2 2.6e-13 Alignments of top-scoring domains: SM00336: domain 1 of 1, from 105 to 147: score 55.6, E = 6.3e-12 *->eraplCeeHgdeepaeffCveedgallCrdCdea.geHqanklfrgH ++++Ce+H+ e++ +fC +++ +++C +C +++g+H +gH KIAA0898 105 NEKDKCENHH--EKLSVFC-WTCKKCICHQCALWgGMH------GGH 142 rvvll<-* ++++l KIAA0898 143 TFKPL 147 SM00502: domain 1 of 1, from 147 to 269: score 119.3, E = 4.4e-31 *->qreaLeelleklrkkaeelekalkqldsiiqevegGqvdenaeevea + e++e++++k++++ ++l+++l++l+s++qeve +n e v++ KIAA0898 147 LAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVE-----RNVEAVRN 188 eikaafdeLrnaLnerkkqLledLeevkenklkkLeqQlesltqkqekle +++++e+rna++ +++++L+++ +nkl++L+ Q++sltq +e le KIAA0898 189 AKDERVREIRNAVE----MMIARLDTQLKNKLITLMGQKTSLTQETELLE 234 hainfaeeaLnsgdptelLlskkliierlqellkq<-* ++++ +e++L+s++++el++++ +i +++q+++++ KIAA0898 235 SLLQEVEHQLRSCSKSELISKSSEILMMFQQVHRK 269 SM00061: domain 1 of 1, from 296 to 399: score 60.2, E = 2.6e-13 *->vlshtfknvSkfKLateegesyfSpseehkggfnipWrlkikrkG.. + ++f+ ++ + ++Sp+ + +++Wrlk++++G++ KIAA0898 296 FVLENFSTLR------QRADPVYSPPLQV---SGLCWRLKVYPDGng 333 .gkngflglyLhCekeeceerlevkWsieaeftlkLvsqnGksl.rsvir ++ +l+++L ++ e + + e ++++ s+n + +++ KIAA0898 334 vVRGYYLSVFLELSAGLPE-----TSKYEYRVEMVHQSCNDPTKnI---- 374 hvkfaskkdthvFekpsgwGfskFisWddL<-* + + + Fe +++wG+++F+++d L KIAA0898 375 -----IREFASDFEVGECWGYNRFFRLDLL 399 //