hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18263366/chunk_1/iprscan-20080502-18263366.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0975 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00787.14.fs PX domain 99.9 5.8e-30 1 PF00787.14.ls PX domain 101.7 2.1e-27 1 PF00560.23.ls Leucine Rich Repeat 60.8 4.1e-15 6 PF00560.23.fs Leucine Rich Repeat 49.8 1.4e-12 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00787.14.fs 1/1 38 142 .. 1 131 [] 99.9 5.8e-30 PF00787.14.ls 1/1 38 142 .. 1 131 [] 101.7 2.1e-27 PF00560.23.ls 1/6 312 333 .. 1 24 [] 12.3 1.3 PF00560.23.ls 2/6 335 355 .. 1 24 [] 10.9 2.4 PF00560.23.ls 3/6 357 377 .. 1 24 [] 11.7 1.7 PF00560.23.ls 4/6 380 400 .. 1 24 [] 12.1 1.4 PF00560.23.ls 5/6 402 422 .. 1 24 [] 8.1 8.2 Alignments of top-scoring domains: PF00787.14.fs: domain 1 of 1, from 38 to 142: score 99.9, E = 5.8e-30 *->dpilivvvvdpetsrkkegdkkhtyyvyevttktn.kewsVkRRYsd +p ++++vv+ + ++ty+vy ++++++++ew+Vk+RYsd KIAA0975 38 EPAKEARVVG--------SELVDTYTVYIIQVTDGsHEWTVKHRYSD 76 FeeLhekLlrkfp.grilPplPpKklfgryrkeslpmtsvwhssnnfdee F++LhekL + + +++l lPpKk++g ++++ KIAA0975 77 FHDLHEKLVAERKiDKNL--LPPKKIIGK-----------------NSRS 107 fiekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* +ekR k+Le+yLq+ll + ++ +v+++FL+++ KIAA0975 108 LVEKREKDLEVYLQKLLAAFPGVT-PRVLAHFLHFH 142 PF00787.14.ls: domain 1 of 1, from 38 to 142: score 101.7, E = 2.1e-27 *->dpilivvvvdpetsrkkegdkkhtyyvyevttktn.kewsVkRRYsd +p ++++vv+ + ++ty+vy ++++++++ew+Vk+RYsd KIAA0975 38 EPAKEARVVG--------SELVDTYTVYIIQVTDGsHEWTVKHRYSD 76 FeeLhekLlrkfp.grilPplPpKklfgryrkeslpmtsvwhssnnfdee F++LhekL + + +++l lPpKk++g ++++ KIAA0975 77 FHDLHEKLVAERKiDKNL--LPPKKIIGK-----------------NSRS 107 fiekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* +ekR k+Le+yLq+ll + ++ +v+++FL+++ KIAA0975 108 LVEKREKDLEVYLQKLLAAFPGVT-PRVLAHFLHFH 142 PF00560.23.ls: domain 1 of 6, from 312 to 333: score 12.3, E = 1.3 *->nLeeLdLsgCNpsltgslpssl.nl<-* L++LdLs+ N s++ ++++s++ KIAA0975 312 ALTTLDLSH-N-SIS-EIDESVkLI 333 PF00560.23.ls: domain 2 of 6, from 335 to 355: score 10.9, E = 2.4 *->nLeeLdLsgCNpsltgslpssl.nl<-* ++e LdLs+ N +l +++ l++l KIAA0975 335 KIEFLDLSH-N-GLL-VVDN-LqHL 355 PF00560.23.ls: domain 3 of 6, from 357 to 377: score 11.7, E = 1.7 *->nLeeLdLsgCNpsltgslpssl.nl<-* nL +LdLs+ N +l+ sl+ l+ KIAA0975 357 NLVHLDLSY-N-KLS-SLEG-LhTK 377 PF00560.23.ls: domain 4 of 6, from 380 to 400: score 12.1, E = 1.4 *->nLeeLdLsgCNpsltgslpssl.nl<-* n+++L+L g N l+ sl+ l++l KIAA0975 380 NIKTLNLAG-N-LLE-SLSG-LhKL 400 PF00560.23.ls: domain 5 of 6, from 402 to 422: score 8.1, E = 8.2 *->nLeeLdLsgCNpsltgslpssl.nl<-* +L +LdL++ N +++ +++ +++ KIAA0975 402 SLVNLDLRD-N-RIE-QMEE-VrSI 422 //