hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15364878/chunk_1/iprscan-20080501-15364878.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1037 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 30.1 0.00029 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/3 253 286 .. 1 34 [] 14.8 10 SM00028 2/3 287 323 .. 1 34 [] 13.6 14 SM00028 3/3 324 357 .. 1 34 [] 1.7 3.2e+02 Alignments of top-scoring domains: SM00028: domain 1 of 3, from 253 to 286: score 14.8, E = 10 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* e ++++n ++ ++ +Ai+ y+kA++ +P+n KIAA1037 253 LERVKQQANEAFACQQWTQAIQLYSKAVQRAPHN 286 SM00028: domain 2 of 3, from 287 to 323: score 13.6, E = 14 *->aealynlGnaylkl...gdydeAieyyekALeldPnn<-* a + n++ ay+k++ +gd+ +A+ ++ kA++l+P + KIAA1037 287 AMLYGNRAAAYMKRkwdGDHYDALRDCLKAISLNPCH 323 SM00028: domain 3 of 3, from 324 to 357: score 1.7, E = 3.2e+02 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +a+++l+ +++ l+ +eA+e+++ P+ KIAA1037 324 LKAHFRLARCLFELKYVAEALECLDDFKGKFPEQ 357 //