hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18465128/chunk_1/iprscan-20080501-18465128.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1150 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00320.17.fs GATA zinc finger 35.4 1.3e-09 1 PF00320.17.ls GATA zinc finger 37.4 4.6e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00320.17.fs 1/1 326 360 .. 1 36 [] 35.4 1.3e-09 PF00320.17.ls 1/1 326 360 .. 1 36 [] 37.4 4.6e-08 Alignments of top-scoring domains: PF00320.17.fs: domain 1 of 1, from 326 to 360: score 35.4, E = 1.3e-09 *->CsnCgttkTplWRrgpdGnrtLCNACGLyykkhgvk<-* C++C+t+ Tp+W +G++ LC C+ k+ +k KIAA1150 326 CAQCRTDFTPHWKQEKNGKI-LCEQCMTSNQKKALK 360 PF00320.17.ls: domain 1 of 1, from 326 to 360: score 37.4, E = 4.6e-08 *->CsnCgttkTplWRrgpdGnrtLCNACGLyykkhgvk<-* C++C+t+ Tp+W +G++ LC C+ k+ +k KIAA1150 326 CAQCRTDFTPHWKQEKNGKI-LCEQCMTSNQKKALK 360 //