hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-21084256/chunk_1/iprscan-20080501-21084256.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1235 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00501 153.8 1.8e-41 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00501 1/1 303 394 .. 1 95 [] 153.8 1.8e-41 Alignments of top-scoring domains: SM00501: domain 1 of 1, from 303 to 394: score 153.8, E = 1.8e-41 *->rerelFldrLykFmeergtpilkiPviggkpklDLyrLyrlVkerGG +er+l+ dr+ Fmeerg+p+ ++P++g+kp lDL+rLy++Vke GG KIAA1235 303 PERKLWVDRYLTFMEERGSPVSSLPAVGKKP-LDLFRLYVCVKEIGG 348 ydaVtkdkkWkeiaeelgipdtistsasssLrkhYlryLlpfEeflrg<- +++V+k+kkW+e+a+ l+ ++ s+sa+ssL+k+Y++yL++fE+ +++ KIAA1235 349 LAQVNKNKKWRELATNLNVGT--SSSAASSLKKQYIQYLFAFECKIER 394 * KIAA1235 - - //