hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-21232797/chunk_1/iprscan-20080501-21232797.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1243 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02037.17.fs SAP domain 53.4 8.8e-14 1 PF02037.17.ls SAP domain 55.4 1.8e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02037.17.fs 1/1 129 163 .. 1 35 [] 53.4 8.8e-14 PF02037.17.ls 1/1 129 163 .. 1 35 [] 55.4 1.8e-13 Alignments of top-scoring domains: PF02037.17.fs: domain 1 of 1, from 129 to 163: score 53.4, E = 8.8e-14 *->lskLkVseLKeeLkkrGLstsGkKaeLveRLleal<-* l+ LkVseLK eLk rGL++sG+K++L+eRL+ + KIAA1243 129 LDDLKVSELKTELKLRGLPVSGTKPDLIERLKPYQ 163 PF02037.17.ls: domain 1 of 1, from 129 to 163: score 55.4, E = 1.8e-13 *->lskLkVseLKeeLkkrGLstsGkKaeLveRLleal<-* l+ LkVseLK eLk rGL++sG+K++L+eRL+ + KIAA1243 129 LDDLKVSELKTELKLRGLPVSGTKPDLIERLKPYQ 163 //