hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22280602/chunk_1/iprscan-20080501-22280602.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1282 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00100 69.0 5.8e-16 1 SM00086 34.6 1.4e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00086 1/1 128 170 .. 1 43 [] 34.6 1.4e-05 SM00100 1/1 616 731 .. 1 123 [] 69.0 5.8e-16 Alignments of top-scoring domains: SM00086: domain 1 of 1, from 128 to 170: score 34.6, E = 1.4e-05 *->tveyrlrrkdGsliwvlvsaspirdedgevegilgvvrDITer<-* + e++l+rk G ++w+l+ + pi +e+gev +l ++ DI+e KIAA1282 128 KAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDISET 170 SM00100: domain 1 of 1, from 616 to 731: score 69.0, E = 5.8e-16 *->lfkaldaeelreladalepvrypaGevifrqGdpgdsfYiivsGeve lf+a+++++lr+l+ al+p ++ +Ge++++qGd+ +Y++ sG++e KIAA1282 616 LFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSME 662 vyktrlstledgreqilatlgpGdfFG.Elall..rrarsaaavalvela v+k +++la+lg+Gd++G El+ ++ ++a+++ l +++ KIAA1282 663 VLKG---------GTVLAILGKGDLIGcELPRReqVVKANADVKGL-TYC 702 tllridferflqllpenpqlllelllell<-* l + + + + l+ +p+++ ++ + l KIAA1282 703 VLQCLQLAGLHDSLALYPEFAPRFSRGLR 731 //