hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22280602/chunk_1/iprscan-20080501-22280602.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1282 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR00229 sensory_box: PAS domain S-box 27.9 1.2e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR00229 1/1 50 177 .. 1 130 [] 27.9 1.2e-05 Alignments of top-scoring domains: TIGR00229: domain 1 of 1, from 50 to 177: score 27.9, E = 1.2e-05 *->reseeryraifesspdaiivvdleGnilyvnpafeelfGysaeellG +r+ + + v ++y +++f++l+G+s++e++ KIAA1282 50 DTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQ 96 rnvle.lipeedreelrerierlletgerepvseerrvlgrrkdGseiwv r+ +++ +d el + + r e++ + e + +rk G +w+ KIAA1282 97 RGCACsFLYGPDTSELVRQQIRKAL-DEHKEFKAELIL--YRKSGLPFWC 143 evsvspirdsnggvlgvlgivrDiterkeaeeal<-* ++ v pi ++ g+v +l +++Di+e k+ KIAA1282 144 LLDVIPIKNEKGEVALFLVSHKDISETKNRGGPD 177 //