hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-02523000/chunk_1/iprscan-20080502-02523000.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1438 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02755.6.fs RPEL repeat 54.6 4e-16 3 PF02755.6.ls RPEL repeat 60.6 4.8e-15 3 PF02037.17.fs SAP domain 56.2 1.5e-14 2 PF02037.17.ls SAP domain 56.3 9.3e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02037.17.fs 1/2 491 525 .. 1 35 [] 54.3 4.8e-14 PF02037.17.ls 1/1 491 525 .. 1 35 [] 56.3 9.3e-14 Alignments of top-scoring domains: PF02037.17.fs: domain 1 of 2, from 491 to 525: score 54.3, E = 4.8e-14 *->lskLkVseLKeeLkkrGLstsGkKaeLveRLleal<-* l+ +kV+eLK+eLk r L++sG+K+eL+eRL+++ KIAA1438 491 LDDMKVAELKQELKLRSLPVSGTKTELIERLRAYQ 525 PF02037.17.ls: domain 1 of 1, from 491 to 525: score 56.3, E = 9.3e-14 *->lskLkVseLKeeLkkrGLstsGkKaeLveRLleal<-* l+ +kV+eLK+eLk r L++sG+K+eL+eRL+++ KIAA1438 491 LDDMKVAELKQELKLRSLPVSGTKTELIERLRAYQ 525 //