hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-02523000/chunk_1/iprscan-20080502-02523000.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1438 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00707 128.5 7.2e-34 3 SM00513 48.9 6.5e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00707 1/3 124 149 .. 1 26 [] 39.4 5e-07 SM00707 2/3 168 193 .. 1 26 [] 44.3 1.6e-08 SM00707 3/3 212 237 .. 1 26 [] 44.8 1.1e-08 SM00513 1/1 491 525 .. 1 35 [] 48.9 6.5e-10 Alignments of top-scoring domains: SM00707: domain 1 of 3, from 124 to 149: score 39.4, E = 5e-07 *->drLkrKLsqRPtreELeernILkees<-* +L++KL+qR+treEL++++I+++++ KIAA1438 124 NVLQLKLQQRRTREELVSQGIMPPLK 149 SM00707: domain 2 of 3, from 168 to 193: score 44.3, E = 1.6e-08 *->drLkrKLsqRPtreELeernILkees<-* d+LkrK++ RP+r+EL++++IL+e+s KIAA1438 168 DYLKRKIRSRPERSELVRMHILEETS 193 SM00707: domain 3 of 3, from 212 to 237: score 44.8, E = 1.1e-08 *->drLkrKLsqRPtreELeernILkees<-* d+L++K+ qRP+++EL+e+nIL+ es KIAA1438 212 DDLNEKIAQRPGPMELVEKNILPVES 237 SM00513: domain 1 of 1, from 491 to 525: score 48.9, E = 6.5e-10 *->lskLkVseLkdeLkkrGLstsGrKaeLvkRLleal<-* l +kV+eLk+eLk r L++sG+K+eL++RL+++ KIAA1438 491 LDDMKVAELKQELKLRSLPVSGTKTELIERLRAYQ 525 //