hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-05365944/chunk_1/iprscan-20080502-05365944.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1535 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00100 83.2 3.2e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00100 1/1 365 478 .. 1 123 [] 83.2 3.2e-20 Alignments of top-scoring domains: SM00100: domain 1 of 1, from 365 to 478: score 83.2, E = 3.2e-20 *->lfkaldaeelreladalepvrypaGevifrqGdpgdsfYiivsGeve lf+++d+++ ++++ +l+ +++++G+ ++r+G +g +Y+i +G + KIAA1535 365 LFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLS 411 vyktrlstledgreqilatlgpGdfFGElall.rrarsaaavalvelatl v+++ + ++l+ G++FGE++ll+r +r+a+++a ++++l KIAA1535 412 VLAR---------GARDTRLTDGSYFGEICLLtRGRRTASVRAD-TYCRL 451 lridferflqllpenpqlllelllell<-* ++ ++f l+e+p++ +++ KIAA1535 452 YSLSVDHFNAVLEEFPMMRRAFETVAM 478 //