hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-07182539/chunk_1/iprscan-20080502-07182539.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1595 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00271.21.fs Helicase conserved C-terminal domain 97.4 8e-28 1 PF00271.21.ls Helicase conserved C-terminal domain 99.4 1e-26 1 PF00270.19.fs DEAD/DEAH box helicase 83.9 4.3e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00270.19.fs 1/1 7 83 .. 125 213 .] 83.9 4.3e-23 PF00271.21.fs 1/1 159 234 .. 1 76 [] 97.4 8e-28 PF00271.21.ls 1/1 159 234 .. 1 76 [] 99.4 1e-26 Alignments of top-scoring domains: PF00270.19.fs: domain 1 of 1, from 7 to 83: score 83.9, E = 4.3e-23 RF xxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxx *->dIlvgTPgrLldlllkgrkregasld....lknlkllVlDEAhrlld +I+v+TPgrL d++ +rk ++ ld + +++l +lVlDEA+rlld KIAA1595 7 NIIVATPGRLEDMF--RRKA-EG-LDlascVRSLDVLVLDEADRLLD 49 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx mkGfgedleeilrrlprpklrrlsqdlpnrqtllfSATlprnvedl<-* m Gf++ + il+ lp ++ r+t lfSAT +++ve+l KIAA1595 50 M-GFEASINTILEFLP-KQ----------RRTGLFSATQTQEVENL 83 PF00271.21.fs: domain 1 of 1, from 159 to 234: score 97.4, E = 8e-28 *->ll.epgikvarlhGglsqeeReeilekFrngkskvLvaTdvagrGiD + +g+k+ ++hG +++ +R +i+ +Fr+ s +Lv+Tdv++rGiD KIAA1595 159 EVlVKGVKIMCIHG-KMKYKRNKIFMEFRKLQSGILVCTDVMARGID 204 ipdvnlVInydlpwnpesyiQRiGRaGRaG<-* ip+vn+V +yd+p n + +++R+GR++R+G KIAA1595 205 IPEVNWVLQYDPPSNASAFVHRCGRTARIG 234 PF00271.21.ls: domain 1 of 1, from 159 to 234: score 99.4, E = 1e-26 *->ll.epgikvarlhGglsqeeReeilekFrngkskvLvaTdvagrGiD + +g+k+ ++hG +++ +R +i+ +Fr+ s +Lv+Tdv++rGiD KIAA1595 159 EVlVKGVKIMCIHG-KMKYKRNKIFMEFRKLQSGILVCTDVMARGID 204 ipdvnlVInydlpwnpesyiQRiGRaGRaG<-* ip+vn+V +yd+p n + +++R+GR++R+G KIAA1595 205 IPEVNWVLQYDPPSNASAFVHRCGRTARIG 234 //