hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-07595345/chunk_1/iprscan-20080502-07595345.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1620 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00595.14.fs PDZ domain (Also known as DHR or GLGF) 25.8 1.4e-06 1 PF00595.14.ls PDZ domain (Also known as DHR or GLGF) 15.2 0.017 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00595.14.fs 1/1 20 69 .. 1 55 [. 25.8 1.4e-06 PF00595.14.ls 1/1 20 99 .. 1 86 [] 15.2 0.017 Alignments of top-scoring domains: PF00595.14.fs: domain 1 of 1, from 20 to 69: score 25.8, E = 1.4e-06 *->evtlekedkrgglGfsikggsdkgadkgifvsevlpGsgaAeagGrL e+++e e + g G++++gg+++ gifv e+ ++ ++A+++ +L KIAA1620 20 EIIVETEAQTGVSGINVAGGGKE----GIFVRELRED-SPAARSLSL 61 qaGDqIls<-* q+GDq+ls KIAA1620 62 QEGDQLLS 69 PF00595.14.ls: domain 1 of 1, from 20 to 99: score 15.2, E = 0.017 *->evtlekedkrgglGfsikggsdkgadkgifvsevlpGsgaAeagGrL e+++e e + g G++++gg+++ gifv e+ ++ ++A+++ +L KIAA1620 20 EIIVETEAQTGVSGINVAGGGKE----GIFVRELRED-SPAARSLSL 61 qaGDqIlsvNGqdlenlsheeavlalkgsggsevtLtvl<-* q+GDq+ls + +en+ e+a +l+ + +v+ ++ KIAA1620 62 QEGDQLLSA-RVFFENFKYEDALRLLQCAEPYKVSFCLK 99 //