hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-08393329/chunk_1/iprscan-20080502-08393329.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1643 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01363.12.ls FYVE zinc finger 96.7 6.4e-26 1 PF01363.12.fs FYVE zinc finger 94.9 1.7e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01363.12.fs 1/1 918 984 .. 1 77 [] 94.9 1.7e-25 PF01363.12.ls 1/1 918 984 .. 1 77 [] 96.7 6.4e-26 Alignments of top-scoring domains: PF01363.12.fs: domain 1 of 1, from 918 to 984: score 94.9, E = 1.7e-25 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll p WvpDe+ +C+ C+ pFt +++R+HHCR+CG+ifC+ Css++++l KIAA1643 918 PEWVPDEACGFCTACKAPFT-VIRRKHHCRSCGKIFCSRCSSHSAPL 963 pylgiaallkndviekpvRVCdsCydrlnk<-* p g kpvRVC +Cy ++ KIAA1643 964 PRYGQ---------VKPVRVCTHCYMFHVT 984 PF01363.12.ls: domain 1 of 1, from 918 to 984: score 96.7, E = 6.4e-26 *->phWvpDeevsnCmrCgkpFtkltkRrHHCRaCGrifCgsCssktvll p WvpDe+ +C+ C+ pFt +++R+HHCR+CG+ifC+ Css++++l KIAA1643 918 PEWVPDEACGFCTACKAPFT-VIRRKHHCRSCGKIFCSRCSSHSAPL 963 pylgiaallkndviekpvRVCdsCydrlnk<-* p g kpvRVC +Cy ++ KIAA1643 964 PRYGQ---------VKPVRVCTHCYMFHVT 984 //