# /hgtech/tools/fasta-34.26.5_v890/fasta34_t -T 8 -b50 -d10 -E0.01 -H -O./tmp/fg05002.fasta.nr -Q ../query/KIAA1648.ptfa /cdna2/lib/nr/nr 2 FASTA searches a protein or DNA sequence data bank version 34.26.5 April 26, 2007 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 KIAA1648, 112 aa vs /cdna2/lib/nr/nr library 2693465022 residues in 7827732 sequences statistics sampled from 60000 to 7826979 sequences Expectation_n fit: rho(ln(x))= 4.7855+/-0.000189; mu= 7.7860+/- 0.011 mean_var=67.6518+/-13.352, 0's: 48 Z-trim: 48 B-trim: 3282 in 2/63 Lambda= 0.155932 FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 The best scores are: opt bits E(7827732) gi|55731444|emb|CAH92435.1| hypothetical protein [ ( 248) 636 151.0 7.7e-35 >>gi|55731444|emb|CAH92435.1| hypothetical protein [Pong (248 aa) initn: 636 init1: 636 opt: 636 Z-score: 781.7 bits: 151.0 E(): 7.7e-35 Smith-Waterman score: 636; 94.624% identity (95.699% similar) in 93 aa overlap (20-112:156-248) 10 20 30 40 KIAA16 GGIGVNTGMPELRHPRQEEVCTHTSQEETSLPGRTDDQPWLSLRSGGPP ::::::::::::: ::.::::::: ::::: gi|557 ILDALQGLLHLGGNWGKHWDAGAQASQTGGVCTHTSQEETSLPERTEDQPWLSLGSGGPP 130 140 150 160 170 180 50 60 70 80 90 100 KIAA16 RHTAHWVKEYPGGVRSMTHLPGTSTWGCQAATPAAVLTGPGRGTDPPLENDTSNIRMCQL ::::::::::::::::::: ::::::::::::: :::::::::::::::::::::::::: gi|557 RHTAHWVKEYPGGVRSMTHPPGTSTWGCQAATPEAVLTGPGRGTDPPLENDTSNIRMCQL 190 200 210 220 230 240 110 KIAA16 DLC ::: gi|557 DLC 112 residues in 1 query sequences 2693465022 residues in 7827732 library sequences Tcomplib [34.26] (8 proc) start: Thu Mar 5 08:30:19 2009 done: Thu Mar 5 08:36:34 2009 Total Scan time: 942.350 Total Display time: 0.010 Function used was FASTA [version 34.26.5 April 26, 2007]