hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12485850/chunk_1/iprscan-20080502-12485850.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1788 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00389 110.8 1.6e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00389 1/1 216 278 .. 1 63 [] 110.8 1.6e-28 Alignments of top-scoring domains: SM00389: domain 1 of 1, from 216 to 278: score 110.8, E = 1.6e-28 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv krr+Rt+ft++QleeLEk+F+k++YP++ re+LA ++ Lte++V+v KIAA1788 216 KRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQV 262 WFQNRRakwkrqekkk<-* WFQNRRakw+++e+ KIAA1788 263 WFQNRRAKWRKRERFG 278 //