hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-14035572/chunk_1/iprscan-20080502-14035572.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1832 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00750 117.1 1.9e-30 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00750 1/1 22 183 .. 1 242 [] 117.1 1.9e-30 Alignments of top-scoring domains: SM00750: domain 1 of 1, from 22 to 183: score 117.1, E = 1.9e-30 *->vSLaeiLevrgrPLsEeEaWAVclqcarsLrevarkaslaaadiegr iL r + c++ L ++ KIAA1832 22 ----NILFIR----------SMSCLCLGLLWTDSC------------ 42 vrltadlllvredGsVsfqepasstpKEqepderafvpPelaqgqsetdl +++ +++ + +pa+ p+ +++vpP + KIAA1832 43 ---CLPGRVLG-----PLHPPAAF-----SPPHPPAVPPSDRA----P-- 73 sdsSSGDSSvinRAFDnSnHHHHHqHHHPPLvvSeeahvysLGavlyaAl ++v+sLG+++y+Al KIAA1832 74 ----------------------------------VPQTVQSLGFAIYRAL 89 dYglpeneeleLsqpLeslllrMaaddpedrcelesieeaceekedeeae d+gl+e+ee+eLs++Le+l++ Ma++d ed+ +++++e++ +++e+eeae KIAA1832 90 DWGLDESEERELSPQLERLIDLMANNDSEDSGCGAADEGYGGPEEEEEAE 139 eerravrsleeamkvCrasrllqrreasnhylAvcralfeetlel<-* +++r+vr++++am++C a+rl+++r+a++hy+Avcralf+etlel KIAA1832 140 GVPRSVRTFAQAMRLC-AARLTDPRGAQAHYQAVCRALFVETLEL 183 //