hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-14241885/chunk_1/iprscan-20080502-14241885.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1844 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00397.16.fs WW domain 38.3 9.2e-10 1 PF00397.16.ls WW domain 40.4 5.9e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00397.16.fs 1/1 63 92 .. 1 30 [] 38.3 9.2e-10 PF00397.16.ls 1/1 63 92 .. 1 30 [] 40.4 5.9e-09 Alignments of top-scoring domains: PF00397.16.fs: domain 1 of 1, from 63 to 92: score 38.3, E = 9.2e-10 *->lppgWeertdpdGrpYYyNhnTktTqWekP<-* + W e+++++G++YYyN T +qWekP KIAA1844 63 SADDWSEHISSSGKKYYYNCRTEVSQWEKP 92 PF00397.16.ls: domain 1 of 1, from 63 to 92: score 40.4, E = 5.9e-09 *->lppgWeertdpdGrpYYyNhnTktTqWekP<-* + W e+++++G++YYyN T +qWekP KIAA1844 63 SADDWSEHISSSGKKYYYNCRTEVSQWEKP 92 //