hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-18200075/chunk_1/iprscan-20080502-18200075.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1983 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07645.6.fs Calcium binding EGF domain 47.6 1.1e-13 1 PF01391.8.fs Collagen triple helix repeat (20 copies) 47.7 5.6e-12 2 PF07645.6.ls Calcium binding EGF domain 49.3 1.2e-11 1 PF00008.17.fs EGF-like domain 43.8 2.2e-11 2 PF00008.17.ls EGF-like domain 43.7 5.9e-10 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07645.6.fs 1/1 146 186 .. 1 55 [] 47.6 1.1e-13 PF07645.6.ls 1/1 146 186 .. 1 55 [] 49.3 1.2e-11 PF00008.17.fs 2/2 150 186 .. 1 38 [] 32.1 4.2e-08 PF00008.17.ls 2/2 150 186 .. 1 38 [] 34.1 4.6e-07 PF01391.8.fs 1/2 257 302 .. 1 47 [. 27.8 1.2e-06 PF01391.8.fs 2/2 312 345 .. 1 34 [. 20.0 0.00014 Alignments of top-scoring domains: PF07645.6.fs: domain 1 of 1, from 146 to 186: score 47.6, E = 1.1e-13 *->DvDECad..gtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpv D+DECa+++gt C + +C+Nt GS++C+ C+eGY KIAA1983 146 DIDECASsnGT--LC-----AHICINTLGSYRCE----CREGYI--- 178 sennedgtnC<-* +dg++C KIAA1983 179 --REDDGKTC 186 PF07645.6.ls: domain 1 of 1, from 146 to 186: score 49.3, E = 1.2e-11 *->DvDECad..gtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpv D+DECa+++gt C + +C+Nt GS++C+ C+eGY KIAA1983 146 DIDECASsnGT--LC-----AHICINTLGSYRCE----CREGYI--- 178 sennedgtnC<-* +dg++C KIAA1983 179 --REDDGKTC 186 PF00008.17.fs: domain 2 of 2, from 150 to 186: score 32.1, E = 4.2e-08 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n+ C + +C++t g+y+CeC +Gy + +Gk+C KIAA1983 150 CASSNgTLCAH--ICINTLGSYRCECREGYIREDDGKTC 186 PF00008.17.ls: domain 2 of 2, from 150 to 186: score 34.1, E = 4.6e-07 *->Cspnn.gpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C++ n+ C + +C++t g+y+CeC +Gy + +Gk+C KIAA1983 150 CASSNgTLCAH--ICINTLGSYRCECREGYIREDDGKTC 186 PF01391.8.fs: domain 1 of 2, from 257 to 302: score 27.8, E = 1.2e-06 *->GppGppGppGppGppGppGppGpaGapGppGppGepGpPGppGppGp pGppG pG +GppG pGp+G +G+pG+pGppG pGp G+ Gp+Gp KIAA1983 257 -LPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGP 302 <-* KIAA1983 - - PF01391.8.fs: domain 2 of 2, from 312 to 345: score 20.0, E = 0.00014 *->GppGppGppGppGppGppGppGpaGapGppGppG<-* G++Gp GppG+pG +G +G+ G++G++G+pGppG KIAA1983 312 GRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPG 345 //