FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB0917, 117 aa
  1>>>pF1KB0917 117 - 117 aa - 117 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0002+/-0.000658; mu= 11.4465+/- 0.039
 mean_var=56.4883+/-11.487, 0's: 0 Z-trim(109.1): 12  B-trim: 0 in 0/51
 Lambda= 0.170646
 statistics sampled from 10652 (10653) to 10652 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.327), width:  16
 Scan time:  1.420

The best scores are:                                      opt bits E(32554)
CCDS11606.1 SUPT4H1 gene_id:6827|Hs108|chr17       ( 117)  795 203.2   3e-53


>>CCDS11606.1 SUPT4H1 gene_id:6827|Hs108|chr17            (117 aa)
 initn: 795 init1: 795 opt: 795  Z-score: 1069.6  bits: 203.2 E(32554): 3e-53
Smith-Waterman score: 795; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KB0 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KB0 IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
               70        80        90       100       110       




117 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 17:13:50 2016 done: Sat Nov  5 17:13:51 2016
 Total Scan time:  1.420 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]