FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB0917, 117 aa
  1>>>pF1KB0917 117 - 117 aa - 117 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8840+/-0.000308; mu= 12.0221+/- 0.019
 mean_var=55.6054+/-11.284, 0's: 0 Z-trim(115.7): 7  B-trim: 0 in 0/50
 Lambda= 0.171995
 statistics sampled from 26388 (26389) to 26388 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.715), E-opt: 0.2 (0.309), width:  16
 Scan time:  4.510

The best scores are:                                      opt bits E(85289)
NP_003159 (OMIM: 603555) transcription elongation  ( 117)  795 204.8 2.6e-53


>>NP_003159 (OMIM: 603555) transcription elongation fact  (117 aa)
 initn: 795 init1: 795 opt: 795  Z-score: 1078.0  bits: 204.8 E(85289): 2.6e-53
Smith-Waterman score: 795; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KB0 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_003 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KB0 IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_003 IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
               70        80        90       100       110       




117 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 17:13:51 2016 done: Sat Nov  5 17:13:52 2016
 Total Scan time:  4.510 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]