FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB0919, 118 aa
  1>>>pF1KB0919 118 - 118 aa - 118 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.0561+/-0.000532; mu= 8.8986+/- 0.032
 mean_var=94.2124+/-19.020, 0's: 0 Z-trim(116.2): 1  B-trim: 14 in 1/53
 Lambda= 0.132136
 statistics sampled from 16783 (16784) to 16783 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.838), E-opt: 0.2 (0.516), width:  16
 Scan time:  1.810

The best scores are:                                      opt bits E(32554)
CCDS45898.1 C19orf25 gene_id:148223|Hs108|chr19    ( 118)  773 155.7 6.1e-39


>>CCDS45898.1 C19orf25 gene_id:148223|Hs108|chr19         (118 aa)
 initn: 773 init1: 773 opt: 773  Z-score: 812.6  bits: 155.7 E(32554): 6.1e-39
Smith-Waterman score: 773; 100.0% identity (100.0% similar) in 118 aa overlap (1-118:1-118)

               10        20        30        40        50        60
pF1KB0 MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS45 MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGE
               10        20        30        40        50        60

               70        80        90       100       110        
pF1KB0 QLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS45 QLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
               70        80        90       100       110        




118 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 17:14:57 2016 done: Sat Nov  5 17:14:57 2016
 Total Scan time:  1.810 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]