FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB0921, 121 aa 1>>>pF1KB0921 121 - 121 aa - 121 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8028+/-0.000657; mu= 12.0340+/- 0.039 mean_var=46.0775+/- 9.114, 0's: 0 Z-trim(107.1): 8 B-trim: 0 in 0/50 Lambda= 0.188943 statistics sampled from 9380 (9387) to 9380 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.695), E-opt: 0.2 (0.288), width: 16 Scan time: 1.620 The best scores are: opt bits E(32554) CCDS42185.1 CHTF8 gene_id:54921|Hs108|chr16 ( 121) 786 221.2 1.3e-58 >>CCDS42185.1 CHTF8 gene_id:54921|Hs108|chr16 (121 aa) initn: 786 init1: 786 opt: 786 Z-score: 1166.0 bits: 221.2 E(32554): 1.3e-58 Smith-Waterman score: 786; 100.0% identity (100.0% similar) in 121 aa overlap (1-121:1-121) 10 20 30 40 50 60 pF1KB0 MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB0 GKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 GKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKK 70 80 90 100 110 120 pF1KB0 V : CCDS42 V 121 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 17:56:56 2016 done: Sat Nov 5 17:56:56 2016 Total Scan time: 1.620 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]