FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB0947, 178 aa 1>>>pF1KB0947 178 - 178 aa - 178 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0494+/-0.000679; mu= 14.3071+/- 0.041 mean_var=63.3849+/-12.528, 0's: 0 Z-trim(109.6): 2 B-trim: 0 in 0/53 Lambda= 0.161095 statistics sampled from 10997 (10999) to 10997 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.738), E-opt: 0.2 (0.338), width: 16 Scan time: 1.940 The best scores are: opt bits E(32554) CCDS9146.1 ARPC3 gene_id:10094|Hs108|chr12 ( 178) 1216 290.6 3.5e-79 >>CCDS9146.1 ARPC3 gene_id:10094|Hs108|chr12 (178 aa) initn: 1216 init1: 1216 opt: 1216 Z-score: 1535.0 bits: 290.6 E(32554): 3.5e-79 Smith-Waterman score: 1216; 100.0% identity (100.0% similar) in 178 aa overlap (1-178:1-178) 10 20 30 40 50 60 pF1KB0 MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS91 MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB0 KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS91 KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP 70 80 90 100 110 120 130 140 150 160 170 pF1KB0 ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS91 ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ 130 140 150 160 170 178 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 17:59:57 2016 done: Sat Nov 5 17:59:58 2016 Total Scan time: 1.940 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]