FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3387, 90 aa 1>>>pF1KB3387 90 - 90 aa - 90 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.3912+/-0.000684; mu= 3.6143+/- 0.042 mean_var=184.0158+/-36.221, 0's: 0 Z-trim(117.9): 7 B-trim: 1042 in 1/54 Lambda= 0.094547 statistics sampled from 18727 (18734) to 18727 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.855), E-opt: 0.2 (0.575), width: 16 Scan time: 1.560 The best scores are: opt bits E(32554) CCDS283.1 HMGN2 gene_id:3151|Hs108|chr1 ( 90) 607 92.4 4.1e-20 CCDS4615.1 HMGN4 gene_id:10473|Hs108|chr6 ( 90) 534 82.4 4.1e-17 >>CCDS283.1 HMGN2 gene_id:3151|Hs108|chr1 (90 aa) initn: 607 init1: 607 opt: 607 Z-score: 474.6 bits: 92.4 E(32554): 4.1e-20 Smith-Waterman score: 607; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90) 10 20 30 40 50 60 pF1KB3 MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS28 MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKA 10 20 30 40 50 60 70 80 90 pF1KB3 DAGKEGNNPAENGDAKTDQAQKAEGAGDAK :::::::::::::::::::::::::::::: CCDS28 DAGKEGNNPAENGDAKTDQAQKAEGAGDAK 70 80 90 >>CCDS4615.1 HMGN4 gene_id:10473|Hs108|chr6 (90 aa) initn: 534 init1: 534 opt: 534 Z-score: 420.8 bits: 82.4 E(32554): 4.1e-17 Smith-Waterman score: 534; 86.7% identity (96.7% similar) in 90 aa overlap (1-90:1-90) 10 20 30 40 50 60 pF1KB3 MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKA ::::::.::::::::::::::::::::::::::::::::.:::: ::::::.:::.:::: CCDS46 MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKA 10 20 30 40 50 60 70 80 90 pF1KB3 DAGKEGNNPAENGDAKTDQAQKAEGAGDAK ::::.:::::.: ::.: :.:::::.:::: CCDS46 DAGKDGNNPAKNRDASTLQSQKAEGTGDAK 70 80 90 90 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Fri Nov 4 02:16:12 2016 done: Fri Nov 4 02:16:12 2016 Total Scan time: 1.560 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]