Result of FASTA (ccds) for pF1KB3400
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB3400, 105 aa
  1>>>pF1KB3400 105 - 105 aa - 105 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0837+/-0.000593; mu= 10.4765+/- 0.036
 mean_var=52.9192+/-10.558, 0's: 0 Z-trim(110.7): 8  B-trim: 61 in 1/49
 Lambda= 0.176306
 statistics sampled from 11809 (11815) to 11809 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.759), E-opt: 0.2 (0.363), width:  16
 Scan time:  1.460

The best scores are:                                      opt bits E(32554)
CCDS5393.1 CYCS gene_id:54205|Hs108|chr7           ( 105)  710 187.6 1.2e-48


>>CCDS5393.1 CYCS gene_id:54205|Hs108|chr7                (105 aa)
 initn: 710 init1: 710 opt: 710  Z-score: 987.0  bits: 187.6 E(32554): 1.2e-48
Smith-Waterman score: 710; 100.0% identity (100.0% similar) in 105 aa overlap (1-105:1-105)

               10        20        30        40        50        60
pF1KB3 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS53 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
               10        20        30        40        50        60

               70        80        90       100     
pF1KB3 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
       :::::::::::::::::::::::::::::::::::::::::::::
CCDS53 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
               70        80        90       100     




105 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 02:28:49 2016 done: Sat Nov  5 02:28:49 2016
 Total Scan time:  1.460 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com