FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB3400, 105 aa
  1>>>pF1KB3400 105 - 105 aa - 105 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4635+/-0.000295; mu= 14.2477+/- 0.018
 mean_var=54.2454+/-11.172, 0's: 0 Z-trim(117.4): 18  B-trim: 301 in 1/50
 Lambda= 0.174138
 statistics sampled from 29403 (29416) to 29403 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.746), E-opt: 0.2 (0.345), width:  16
 Scan time:  3.500

The best scores are:                                      opt bits E(85289)
NP_061820 (OMIM: 123970,612004) cytochrome c [Homo ( 105)  710 185.4 1.5e-47


>>NP_061820 (OMIM: 123970,612004) cytochrome c [Homo sap  (105 aa)
 initn: 710 init1: 710 opt: 710  Z-score: 974.8  bits: 185.4 E(85289): 1.5e-47
Smith-Waterman score: 710; 100.0% identity (100.0% similar) in 105 aa overlap (1-105:1-105)

               10        20        30        40        50        60
pF1KB3 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_061 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
               10        20        30        40        50        60

               70        80        90       100     
pF1KB3 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
       :::::::::::::::::::::::::::::::::::::::::::::
NP_061 GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
               70        80        90       100     




105 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 02:28:49 2016 done: Sat Nov  5 02:28:50 2016
 Total Scan time:  3.500 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]