FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3416, 137 aa 1>>>pF1KB3416 137 - 137 aa - 137 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2768+/-0.000624; mu= 10.6038+/- 0.037 mean_var=53.0221+/-10.637, 0's: 0 Z-trim(110.6): 8 B-trim: 2 in 1/48 Lambda= 0.176135 statistics sampled from 11717 (11720) to 11717 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.76), E-opt: 0.2 (0.36), width: 16 Scan time: 1.760 The best scores are: opt bits E(32554) CCDS7323.1 MRPS16 gene_id:51021|Hs108|chr10 ( 137) 929 243.3 3.6e-65 >>CCDS7323.1 MRPS16 gene_id:51021|Hs108|chr10 (137 aa) initn: 929 init1: 929 opt: 929 Z-score: 1283.6 bits: 243.3 E(32554): 3.6e-65 Smith-Waterman score: 929; 100.0% identity (100.0% similar) in 137 aa overlap (1-137:1-137) 10 20 30 40 50 60 pF1KB3 MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS73 MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB3 HGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS73 HGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL 70 80 90 100 110 120 130 pF1KB3 ASQKTDAEATDTEATET ::::::::::::::::: CCDS73 ASQKTDAEATDTEATET 130 137 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 04:59:17 2016 done: Sat Nov 5 04:59:17 2016 Total Scan time: 1.760 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]