FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3444, 140 aa 1>>>pF1KB3444 140 - 140 aa - 140 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8330+/-0.00064; mu= 13.2530+/- 0.038 mean_var=50.2072+/-10.179, 0's: 0 Z-trim(108.3): 14 B-trim: 0 in 0/51 Lambda= 0.181005 statistics sampled from 10148 (10151) to 10148 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.701), E-opt: 0.2 (0.312), width: 16 Scan time: 1.690 The best scores are: opt bits E(32554) CCDS11330.1 RPL23 gene_id:9349|Hs108|chr17 ( 140) 915 246.0 5.6e-66 >>CCDS11330.1 RPL23 gene_id:9349|Hs108|chr17 (140 aa) initn: 915 init1: 915 opt: 915 Z-score: 1298.0 bits: 246.0 E(32554): 5.6e-66 Smith-Waterman score: 915; 100.0% identity (100.0% similar) in 140 aa overlap (1-140:1-140) 10 20 30 40 50 60 pF1KB3 MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDM 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB3 VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP 70 80 90 100 110 120 130 140 pF1KB3 VAKECADLWPRIASNAGSIA :::::::::::::::::::: CCDS11 VAKECADLWPRIASNAGSIA 130 140 140 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 05:04:22 2016 done: Sat Nov 5 05:04:22 2016 Total Scan time: 1.690 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]