FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB3692, 128 aa 1>>>pF1KB3692 128 - 128 aa - 128 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3281+/-0.000757; mu= 11.0309+/- 0.045 mean_var=77.7836+/-15.554, 0's: 0 Z-trim(110.3): 22 B-trim: 0 in 0/50 Lambda= 0.145422 statistics sampled from 11484 (11497) to 11484 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.736), E-opt: 0.2 (0.353), width: 16 Scan time: 1.670 The best scores are: opt bits E(32554) CCDS7886.1 CD59 gene_id:966|Hs108|chr11 ( 128) 907 198.9 7.2e-52 >>CCDS7886.1 CD59 gene_id:966|Hs108|chr11 (128 aa) initn: 907 init1: 907 opt: 907 Z-score: 1044.7 bits: 198.9 E(32554): 7.2e-52 Smith-Waterman score: 907; 100.0% identity (100.0% similar) in 128 aa overlap (1-128:1-128) 10 20 30 40 50 60 pF1KB3 MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS78 MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KB3 YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS78 YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL 70 80 90 100 110 120 pF1KB3 AAAWSLHP :::::::: CCDS78 AAAWSLHP 128 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 05:19:34 2016 done: Sat Nov 5 05:19:35 2016 Total Scan time: 1.670 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]